missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ KV1.2 (KCNA2) Polyclonal Antibody
GREENER_CHOICE

Código de producto. 17921361
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
17921361 100 μg 100 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 17921361

Marca: Invitrogen™ PA5144086

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: Rat Kidney Tissue, Rat Brain Tissue, Mouse Brain Tissue, Mouse Kidney Tissue. ICC/IF: U20S cell. Flow: A431 cell, C6 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Kcna2 is a voltage-gated potassium channel (KV) that belongs to the 6-TM family of potassium channel and also comprises the Ca2+-activated Slo (actually 7-TM) and the Ca2+-activated SK subfamilies. The alpha-subunits contain a single pore-forming region and combine to form tetramers. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. The diverse functions of potassium channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). The Kcna2 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. Kcna2 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. Further, Kcna2 belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of the Kcna2 gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. Diseases associated with KCNA2 include Epileptic Encephalopathy (Early Infantile, 32) and Undetermined Early-Onset Epileptic Encephalopathy.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno KV1.2 (KCNA2)
Aplicaciones Flow Cytometry, Western Blot, Immunocytochemistry
Clasificación Polyclonal
Concentración 500 μg/mL
Conjugado Unconjugated
Formulación PBS with 5mg BSA and 0.05mg sodium azide
génica KCNA2
N.º de referencia del gen P16389, P63141, P63142
Alias de gen Akr6a4; BK2; CSMK1; delayed rectifier K+ channel; EIEE32; ENSMUSG00000074335; Gm10672; HBK5; HK4; HUKIV; k(v)1.2; KC22; Kca1-2; kcna2; kcna2.S; kcna2-a; KV1.2; Kv1.2' potassium channel; LOC100537815; MK2; Mk-2; NGK1; Potassium (K+) channel protein alpha 2, voltage dependent; potassium channel (BGK5); potassium channel subunit Kv 1.2; potassium channel, voltage gated shaker related subfamily A, member 2; potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog; potassium voltage gated channel shaker related subfamily member 2; potassium voltage-gated channel subfamily A member 2; potassium voltage-gated channel, shaker-related subfamily, member 2; potassium voltage-gated channel, shaker-related subfamily, member 2 a; RAK; RBK2; RCK5; RP11-284N8.1; voltage-dependent K channel; voltage-gated channel, shaker-related subfamily, member 2; voltage-gated K(+) channel HuKIV; Voltage-gated potassium channel HBK5; voltage-gated potassium channel isoform 2; voltage-gated potassium channel isoform 3; voltage-gated potassium channel protein Kv1.2; Voltage-gated potassium channel subunit Kv1.2; XELAEV_18011981mg; XSha2
Símbolos de los genes KCNA2
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV).
Método de purificación Antigen affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 16490, 25468, 3737
Especies diana Human, Mouse, Rat
Contenido y almacenamiento -20°C
Tipo de producto Antibody
Formulario Lyophilized
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.