missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCTD21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-79549
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
KCTD21 Polyclonal specifically detects KCTD21 in Human samples. It is validated for Western Blot.
Especificaciones
| KCTD21 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| BTB/POZ domain-containing protein KCTD21, KCASH2, potassium channel tetramerisation domain containing 21 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 283219 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_001025030 | |
| KCTD21 | |
| Synthetic peptide directed towards the middle region of human KCTD21The immunogen for this antibody is KCTD21. Peptide sequence VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Goat: 100%; Guinea pig: 100%; Mouse: 100%; Rat: 100%; Chicken: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido