missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-17B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-83113-25ul
Código de producto. 18476730
-
433.00€
409.50€ / 25 microlitros
Ahorro 23.50€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
IL-17B Polyclonal specifically detects IL-17B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| IL-17B | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17Binterleukin-17 beta, IL20, IL-20interleukin-17B, interleukin 17B, interleukin 20, Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-20 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IL17B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY | |
| 25 μL | |
| Cytokine Research | |
| 27190 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido