missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ IDO Polyclonal Antibody
Rabbit Polyclonal Antibody
Marca: Invitrogen™ PA579437
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue. IHC: Human Lung Cancer tissue. ICC/IF: A431 cell. Flow: A431 cell.
IDO1 is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring of several important regulatory molecules like tryptophan, serotonin, and melatonin. By doing this, IDO1 initiates the production of biologically active metabolites, commonly referred to as kynurenines. IDO1 is widely expressed in a variety of human tissues as well as in macrophages and dendritic cells (DCs). In inflammation, interferons (IFNs) act on specific receptors to trigger IDO1 induction. The production of IFN-gamma and induction of IDO1 represent important antimicrobial mechanisms. Degradation and depletion of tryptophan by IDO1 inhibits the growth of viruses, bacteria and parasites. Furthermore, IDO1 plays a complex and crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and neoplasia.
Especificaciones
| IDO | |
| Polyclonal | |
| Unconjugated | |
| Ido1 | |
| EC 1.13.11.52; IDO; IDO1; IDO-1; INDO; indolamine 2,3 dioxygenase; indole 2,3-dioxygenase; indoleamine; indoleamine 2,3-dioxygenase 1; indoleamine 23-dioxygenase; Indoleamine-2; indoleamine-pyrrole 2,3 dioxygenase; indoleamine-pyrrole 2,3-dioxygenase | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 3620 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P14902 | |
| Ido1 | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido