missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ IBA1 Polyclonal Antibody
GREENER_CHOICE

Código de producto. 16364675 Tienda Thermo Scientific Productos
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16364675 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16364675 Proveedor Invitrogen™ N.º de proveedor PA595409

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Ionized calcium-binding adapter molecule 1 (IBA1), also known by its gene name AIF1, is a protein expressed predominantly by microglia in the brain and spinal cord. This protein belongs to the EF-hand calcium-binding protein family and plays a crucial role in microglial activation and migration in response to brain injury or neuroinflammation. IBA1's function is integral to microglial motility and phagocytic activity, facilitating the cellular response to pathogenic stimuli and promoting tissue homeostasis and repair in the central nervous system. IBA1 serves as a reliable marker for activated microglia in various neurological disorders, including Alzheimer's disease, Parkinson's disease, and multiple sclerosis, where increased expression correlates with disease progression and severity. The protein's structural features enable it to bind calcium ions, inducing conformational changes that activate signaling pathways essential for microglial function. Its expression is highly regulated by inflammatory cytokines, underpinning its role in neuroimmune responses. Due to its specific expression in microglia during pathological conditions, IBA1 is widely used in research as a marker to study microglial status and activity, and it remains a focal point for understanding microglial involvement in neurodegenerative diseases.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno IBA1
Aplicaciones Immunohistochemistry (Paraffin), Western Blot
Clasificación Polyclonal
Concentración 500 μg/mL
Conjugado Unconjugated
Formulación PBS with 4mg trehalose and no preservative
génica AIF1
N.º de referencia del gen P55008
Alias de gen AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific
Símbolos de los genes AIF1
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
Método de purificación Affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 199
Especies diana Human
Contenido y almacenamiento -20°C
Tipo de producto Antibody
Formulario Lyophilized
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.