missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPRIN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55585-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
GPRIN3 Polyclonal specifically detects GPRIN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| GPRIN3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| G protein-regulated inducer of neurite outgrowth 3, GPRIN family member 3, GRIN3FLJ42625, KIAA2027 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 285513 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| GPRIN3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ASAPSSAAGRDLIHTPLTMPANQHTCQSIPGDQPNAITSSMPEDSLMRSQRTSNREQPEKPSCPVGGVLSSSKDQVSCEFPSPETIQGTVQTPV | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido