missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GluR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
379.00€ - 500.00€
Especificaciones
| Antígeno | GluR1 |
|---|---|
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marque | Cantidad | Prix | Quantité et disponibilité | |||||
|
18479331
|
Novus Biologicals
NBP2-33996-25ul |
25 μL |
379.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18185683
|
Novus Biologicals
NBP2-33996 |
0.1 mL |
500.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Description
GluR1 Polyclonal specifically detects GluR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| GluR1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P42261 | |
| 2890 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Metabotropic Glutamate Receptors, Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AMPA 1, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GluR-1, GLUR1gluR-A, GluR-A, GLURA, GluR-K1, glutamate receptor 1, Glutamate receptor ionotropic, AMPA 1, glutamate receptor, ionotropic, AMPA 1, HBGR1, MGC133252 | |
| GRIA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit