missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-92136-0.1ml
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Dynein light chain 2 cytoplasmic Polyclonal antibody specifically detects Dynein light chain 2 cytoplasmic in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Especificaciones
| Dynein light chain 2 cytoplasmic | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| DLC2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1). MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG | |
| 0.1 mL | |
| Autophagy, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 140735 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido