missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEC2/SHARP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-58737-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
DEC2/SHARP1 Polyclonal specifically detects DEC2/SHARP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| DEC2/SHARP1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1, Differentially expressed in chondrocytes protein 2, SHARP-1, SHARP1hDEC2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79365 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| BHLHE41 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?
For Research Use Only