missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTC-534A2.2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-49564
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
CTC-534A2.2 Polyclonal antibody specifically detects CTC-534A2.2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Especificaciones
| CTC-534A2.2 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| REV7-interacting novel NHEJ regulator 1, RINN1; CTC-534A2.2, shield complex subunit 3, shieldin complex subunit 3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCT | |
| 0.1 mL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido