missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-18 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-92541-0.1ml
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Claudin-18 Polyclonal antibody specifically detects Claudin-18 in Human, Mouse, Rat samples. It is validated for Western Blot
Especificaciones
| Claudin-18 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| claudin 18, SFTA5, SFTPJ, surfactant associated 5, surfactant associated protein J, surfactant, pulmonary associated protein J | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-261 of human Claudin-18 (NP_057453.1). APEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV | |
| 0.1 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 51208 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido