missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16147798

WNT inhibitory factor 1, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Código de producto. 16147798
Change view
Click to view available options
Cantidad:
50 μg
Tamaño de la unidad:
50 microgramos
Código de producto. Cantidad unitSize
16147798 50 μg 50 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16147798

Marca: Abnova H00011197B01P.50ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a full-length human WIF1 protein.

WNT proteins are extracellular signaling molecules involved in the control of embryonic development. This gene encodes a secreted protein, which binds WNT proteins and inhibits their activities. This protein contains a WNT inhibitory factor (WIF) domain and 5 epidermal growth factor (EGF)-like domains. It may be involved in mesoderm segmentation. This protein is found to be present in fish, amphibia and mammals. [provided by RefSeq

Sequence: MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW

Specifications

Antígeno WNT inhibitory factor 1
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a full-length human WIF1 protein.
Formulación PBS with no preservative; pH 7.4
génica WIF1
N.º de referencia del gen BC018037
Alias de gen WIF-1
Símbolos de los genes WIF1
Especie del huésped Mouse
Inmunógeno WIF1 (AAH18037.1, 1 a.a. ∼ 379 a.a) full-length human protein.
Método de purificación Affinity Purified
Cantidad 50 μg
Estado normativo RUO
Disciplina de investigación Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 11197
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.