missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16186975

transient receptor potential cation channel, subfamily C, member 3, Mouse, Polyclonal Antibody, Abnova™

Código de producto. 16186975
Change view
Click to view available options
Cantidad:
50 μL
Tamaño de la unidad:
50 microlitros
Código de producto. Cantidad unitSize
16186975 50 μL 50 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16186975

Marca: Abnova H00007222A01.50uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Description

Mouse polyclonal antibody raised against a partial recombinant TRPC3.

Sequence: TARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQ

Specifications

Antígeno transient receptor potential cation channel, subfamily C, member 3
Aplicaciones ELISA, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a partial recombinant TRPC3.
Formulación 50% glycerol
génica TRPC3
N.º de referencia del gen NM_003305
Alias de gen TRP3
Símbolos de los genes TRPC3
Especie del huésped Mouse
Inmunógeno TRPC3 (NP_003296, 485 a.a. ∼ 535 a.a) partial recombinant protein with GST tag.
Cantidad 50 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 7222
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.