missing translation for 'onlineSavingsMsg'
Learn More

thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian), Mouse, Polyclonal Antibody, Abnova™

Código de producto. 16196615
Change view
Click to view available options
Cantidad:
50 μL
Tamaño de la unidad:
50 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16196615 50 μL 50 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16196615 Proveedor Abnova N.º de proveedor H00007067A01.50uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse polyclonal antibody raised against a partial recombinant THRA.

The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST

Especificaciones

Antígeno thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
Aplicaciones ELISA, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a partial recombinant THRA.
Formulación 50% glycerol
génica THRA
N.º de referencia del gen BC002728
Alias de gen AR7/EAR7/ERB-T-1/ERBA/ERBA1/MGC000261/MGC43240/NR1A1/THRA1/THRA2/c-ERBA-1
Símbolos de los genes THRA
Especie del huésped Mouse
Inmunógeno THRA (AAH02728, 87 a.a. ∼ 178 a.a) partial recombinant protein with GST tag.
Cantidad 50 μL
Estado normativo RUO
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 7067
Especies diana Human, Rat
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Serum
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.