missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16183548

transcription factor A, mitochondrial, Mouse, Polyclonal Antibody, Abnova™

Código de producto. 16183548
Change view
Click to view available options
Cantidad:
50 μg
Tamaño de la unidad:
50 microgramos
Código de producto. Cantidad unitSize
16183548 50 μg 50 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16183548

Marca: Abnova H00007019B01P.50ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse polyclonal antibody raised against a full-length human TFAM protein.

This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq

Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Especificaciones

Antígeno transcription factor A, mitochondrial
Aplicaciones Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a full-length human TFAM protein.
Formulación PBS with no preservative; pH 7.4
génica TFAM
N.º de referencia del gen NM_003201.1
Alias de gen MtTF1/TCF6/TCF6L1/TCF6L2/TCF6L3/mtTFA
Símbolos de los genes TFAM
Especie del huésped Mouse
Inmunógeno TFAM (NP_003192.1, 1 a.a. ∼ 246 a.a) full-length human protein.
Método de purificación Affinity Purified
Cantidad 50 μg
Estado normativo RUO
Disciplina de investigación Cell Cycle
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 7019
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG
Mostrar más Mostrar menos

Seguridad y manipulación

compliance-icons
Nombre del producto
  • TFAM purified MaxPab mouse polyclonal antibody (B01P)
 Palabra de advertencia
  • Atención
 Clasificación
  • Toxicidad aguda Categoría 4
  • Lesión ocular grave/irritación ocular Categoría 2
  • Corrosión o irritación cutáneas Categoría 2
 Indicaciones de peligro
  • H302-Nocivo en caso de ingestión.
  • H312-Nocivo en contacto con la piel.
  • H319-Provoca irritación ocular grave.
 Consejos de prudencia
  • P102-Mantener fuera del alcance de los niños.
  • P103-Leer la etiqueta antes del uso.
  • P233-Mantener el recipiente herméticamente cerrado.
  • P264-Lavarse concienzudamente tras la manipulación.
  • P270-No comer, beber ni fumar durante su utilización.
  • P280-Llevar guantes/prendas/gafas/máscara de protección.
  • P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
  • P304+P340-EN CASO DE INHALACIÓN: Transportar a la persona al aire libre y mantenerla en una posición que le facilite la respiración.
  • P305+P351+P338-EN CASO DE CONTACTO CON LOS OJOS: Aclarar cuidadosamente con agua durante varios minutos. Quitar las lentes de contacto, si lleva y resulta fácil. Seguir aclarando.
  • P404-Almacenar en un recipiente cerrado.
  • P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.
 Otros peligros
  • MIXTURE LIST-Contém: sodium phosphate dibasic, potassium phosphate monobasic,
Título del producto
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.