missing translation for 'onlineSavingsMsg'
Learn More

SERPINI1, Mouse, Clone: 1E10, Abnova™

Código de producto. 16139081
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
16139081 100 μg 100 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16139081

Marca: Abnova H00005274M03.100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse monoclonal antibody raised against a full-length recombinant SERPINI1.

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQEEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Especificaciones

Antígeno SERPINI1
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Clon 1E10
Conjugado Unconjugated
Descripción Mouse monoclonal antibody raised against a full-length recombinant SERPINI1.
Formulación PBS with no preservative; pH 7.4
génica SERPINI1
N.º de referencia del gen BC018043
Alias de gen DKFZp781N13156/PI12/neuroserpin
Símbolos de los genes SERPINI1
Especie del huésped Mouse
Inmunógeno SERPINI1 (AAH18043, 17 a.a. ∼ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Método de purificación Affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 5274
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Formulario Liquid
Isotype IgG1 κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.