missing translation for 'onlineSavingsMsg'
Learn More

v-raf-1 murine leukemia viral oncogene homolog 1, Mouse, Clone: 1H4, Abnova™

Código de producto. 16144065
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
16144065 100 μg 100 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16144065

Marca: Abnova H00005894M03.100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse monoclonal antibody raised against a partial recombinant RAF1.

This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq

Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF

Especificaciones

Antígeno v-raf-1 murine leukemia viral oncogene homolog 1
Aplicaciones ELISA, In situ PLA, KnockDown, Western Blot
Clasificación Monoclonal
Clon 1H4
Conjugado Unconjugated
Descripción Mouse monoclonal antibody raised against a partial recombinant RAF1.
Formulación PBS with no preservative; pH 7.4
génica RAF1
N.º de referencia del gen BC018119
Alias de gen CRAF/NS5/Raf-1/c-Raf
Símbolos de los genes RAF1
Especie del huésped Mouse
Inmunógeno RAF1 (AAH18119, 1 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Método de purificación Affinity Purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Apoptosis
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 5894
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG2b κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.