missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16158535

NCK2, Mouse, Polyclonal Antibody, Abnova™

Código de producto. 16158535
Change view
Click to view available options
Cantidad:
50 μL
Tamaño de la unidad:
50 microlitros
Código de producto. Cantidad unitSize
16158535 50 μL 50 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16158535

Marca: Abnova H00008440A01.50uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Description

Mouse polyclonal antibody raised against a partial recombinant NCK2.

This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: LYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRD

Specifications

Antígeno NCK2
Aplicaciones ELISA, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a partial recombinant NCK2.
Formulación 50% glycerol
génica NCK2
N.º de referencia del gen NM_003581
Alias de gen GRB4/NCKbeta
Símbolos de los genes NCK2
Especie del huésped Mouse
Inmunógeno NCK2 (NP_003572, 203 a.a. ∼ 312 a.a) partial recombinant protein with GST tag.
Cantidad 50 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 8440
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.