missing translation for 'onlineSavingsMsg'
Learn More
Learn More
methionyl-tRNA synthetase, Mouse, Clone: 5G5, Abnova™
Descripción
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene belongs to the class I family of tRNA synthetases. [provided by RefSeq
Sequence: LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKK
Especificaciones
Especificaciones
| Antígeno | methionyl-tRNA synthetase |
| Aplicaciones | ELISA, Immunofluorescence, Western Blot |
| Clasificación | Monoclonal |
| Clon | 5G5 |
| Conjugado | Unconjugated |
| Descripción | Mouse monoclonal antibody raised against a partial recombinant MARS. |
| Formulación | PBS with no preservative; pH 7.4 |
| génica | MARS |
| N.º de referencia del gen | NM_004990 |
| Alias de gen | FLJ35667/METRS/MTRNS |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?