missing translation for 'onlineSavingsMsg'
Learn More

glycine cleavage system protein H (aminomethyl carrier), Mouse, Clone: 3D8-A12, Abnova™

Código de producto. 16125391
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16125391 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16125391 Proveedor Abnova N.º de proveedor H00002653M01.100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse monoclonal antibody raised against a full-length recombinant GCSH.

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.[supplied by OMIM

Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Especificaciones

Antígeno glycine cleavage system protein H (aminomethyl carrier)
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Clon 3D8-A12
Conjugado Unconjugated
Descripción Mouse monoclonal antibody raised against a full length recombinant GCSH.
Formulación PBS with no preservative; pH 7.4
génica GCSH
N.º de referencia del gen BC000790
Alias de gen GCE/NKH
Símbolos de los genes GCSH
Especie del huésped Mouse
Inmunógeno GCSH (AAH00790.1, 1 a.a. ∼ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Método de purificación Affinity Purified
Cantidad 100 μg
Estado normativo RUO
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 2653
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG1 κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.