missing translation for 'onlineSavingsMsg'
Learn More

DUSP5, Mouse, Clone: 3D8, Abnova™

Código de producto. 16197374
Change view
Click to view available options
Cantidad:
200 μL
Tamaño de la unidad:
200 microlitros
Código de producto. Cantidad unitSize
16197374 200 μL 200 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16197374

Marca: Abnova H00001847M02A.200uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse monoclonal antibody raised against a partial recombinant DUSP5.

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq

Sequence: LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC

Especificaciones

Antígeno DUSP5
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Clon 3D8
Conjugado Unconjugated
Descripción Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Formulación ascites with no preservative
génica DUSP5
N.º de referencia del gen NM_004419
Alias de gen DUSP/HVH3
Símbolos de los genes DUSP5
Especie del huésped Mouse
Inmunógeno DUSP5 (NP_004410, 286 a.a. ∼ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Cantidad 200 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 1847
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Formulario Ascites
Isotype IgG1 κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.