missing translation for 'onlineSavingsMsg'
Learn More

APEX nuclease (multifunctional DNA repair enzyme) 1 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Código de producto. 16124724
Change view
Click to view available options
Cantidad:
50 μL
Tamaño de la unidad:
50 microlitros
Código de producto. Cantidad unitSize
16124724 50 μL 50 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16124724

Marca: Abnova H00000328B01

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
Ver productos alternativos

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse polyclonal antibody raised against a full-length human APEX1 protein.

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq]

Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Especificaciones

Antígeno APEX nuclease (multifunctional DNA repair enzyme) 1
Aplicaciones Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a full-length human APEX1 protein.
Formulación No additive
génica APEX1
N.º de referencia del gen NM_001641
Alias de gen APE/APE-1/APE1/APEN/APEX/APX/HAP1/REF-1/REF1
Símbolos de los genes APEX1
Especie del huésped Mouse
Inmunógeno APEX1 (NP_001632, 1 a.a. ∼ 318 a.a) full-length human protein.
Cantidad 50 μL
Estado normativo RUO
Disciplina de investigación Transcription Regulation
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 328
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Serum
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.