missing translation for 'onlineSavingsMsg'
Learn More

ADAM metallopeptidase with thrombospondin type 1 motif, 13, Mouse, Polyclonal Antibody, Abnova™

Código de producto. 16113696
Change view
Click to view available options
Cantidad:
50 μL
Tamaño de la unidad:
50 microlitros
Código de producto. Cantidad unitSize
16113696 50 μL 50 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16113696

Marca: Abnova H00011093A01.50uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse polyclonal antibody raised against a partial recombinant ADAMTS13.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT

Especificaciones

Antígeno ADAM metallopeptidase with thrombospondin type 1 motif, 13
Aplicaciones ELISA, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a partial recombinant ADAMTS13.
Formulación 50% glycerol
génica ADAMTS13
N.º de referencia del gen NM_139025
Alias de gen C9orf8/DKFZp434C2322/FLJ42993/MGC118899/MGC118900/TTP/VWFCP/vWF-CP
Símbolos de los genes ADAMTS13
Especie del huésped Mouse
Inmunógeno ADAMTS13 (NP_620594, 1328 a.a. ∼ 1427 a.a) partial recombinant protein with GST tag.
Cantidad 50 μL
Estado normativo RUO
Disciplina de investigación Signal Transduction
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 11093
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Serum
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.