missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Angiogenin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP3-21287-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Angiogenin Polyclonal antibody specifically detects Angiogenin in Human samples. It is validated for Immunofluorescence
Especificaciones
| Angiogenin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| ALS9, angiogenin, angiogenin, ribonuclease, RNase A family, 5, EC 3.1.27, EC 3.1.27.-, epididymis luminal protein 168, HEL168, MGC22466, MGC71966, Ribonuclease 5, RNase 5, RNASE5RNASE4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGN | |
| 25 μg | |
| Angiogenesis, Cancer | |
| 283 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido