missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16178550

ANAPC4, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Código de producto. 16178550
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
16178550 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16178550

Marca: Abnova PAB31215.100uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

Sequence: VTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHV

Especificaciones

Antígeno ANAPC4
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) The optimal working dilution should be determined by the end user.
Formulación In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
génica anaphase promoting complex subunit 4
Alias de gen APC4
Símbolos de los genes ANAPC4
Especie del huésped Rabbit
Inmunógeno Recombinant protein corresponding to human ANAPC4.
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 29945
Especies diana Human
Contenido y almacenamiento Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Formulario Liquid
Isotype IgG
Mostrar más Mostrar menos
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.