missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTS7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marca: Novus Biologicals NBP2-38539
Código de producto. 18145088
-
624.00€
590.10€ / 0.10 ml
Ahorro 33.90€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ADAMTS7 Polyclonal specifically detects ADAMTS7 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.
Especificaciones
| ADAMTS7 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9UKP4 | |
| ADAMTS7 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| A disintegrin and metalloproteinase with thrombospondin motifs 7, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 7, ADAM metallopeptidase with thrombospondin type 1 motif, 7, ADAM-TS 7, ADAMTS-7, ADAM-TS7a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein, COMPase, DKFZp434H204, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.82 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 11173 | |
| Human, Mouse | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido