missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16364445

Invitrogen™ ACTH Polyclonal Antibody
GREENER_CHOICE

Código de producto. 16364445 Tienda Thermo Scientific Productos
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
16364445 100 μg 100 microgramos
1 options

Código de producto. 16364445

Marca: Invitrogen™ PA595177

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse kidney tissue, rat brain tissue, rat kidney tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ACTH
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Concentración 500 μg/mL
Conjugado Unconjugated
Formulación PBS with 5mg BSA and 0.05mg sodium azide
génica Pomc
N.º de referencia del gen P01189, P01193, P01194
Alias de gen ACTH; adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alphaMSH; alpha-MSH; BE; beta-endorphin; Beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; Clip; Corticotropin; Corticotropin-like intermediary peptide; corticotropin-lipotropin; Gamma-LPH; gamma-MSH; Lipotropin beta; lipotropin gamma; LPH; Melanocyte-stimulating hormone alpha; Melanocyte-stimulating hormone beta; Melanotropin alpha; melanotropin beta; Melanotropin gamma; met-enkephalin; MSH; NPP; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POC; Pomc; Pomc1; Pomc-1; Pomc2; Potential peptide; Precursor of MSH; pro-ACTH-endorphin; proopiomelanocortin; pro-opiomelanocortin; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); pro-opiomelanocortin-alpha; proopoimelanocortin, beta (endorphin, beta)
Símbolos de los genes Pomc
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF).
Método de purificación Affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 18976, 24664, 5443
Especies diana Human, Mouse, Rat
Contenido y almacenamiento -20°C
Tipo de producto Antibody
Formulario Lyophilized
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.