UserName
Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.
Paris, France 01-05-2024
Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.
This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.
"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."
Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.
"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."
This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.
Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.
Questions? Reach Out to a Specialist >
Rabbit Polyclonal Antibody has been used in 1218 publications
Content And Storage | Store at -20°C. |
---|---|
Target Species | Human,Mouse,Rat,Pig,Alligator,Avian,Bacteria,Bovine,Canine,Chicken,Guinea Pig,Hamster,Invertebrate,Monkey,Primate,Rabbit,Golden Syrian Hamster,Zebrafish |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ChIP Assay,ELISA,Flow Cytometry,Immunoassay,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In situ PLA,KnockDown |
Isotype | IgG |
Gene Accession No. | Q9GZQ8 |
Research Discipline | Autophagy, Cancer, Cardiovascular Biology, Cellular Markers, Hypoxia, Innate Immunity, Lipid and Metabolism, Macroautophagy, Mitophagy, Neuroscience |
Concentration | 1.0 mg/mL |
Antigen | LC3B |
Gene Symbols | MAP1LC3B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
Molecular Weight of Antigen | 14.688 kDa |
Gene Alias | anti-LC3B, ATG8F, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, LC3B ihc, LC3B immunohistochemistry, LC3B immunoprecipitation, LC3B western blot, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, MAP1LC3B-a, microtubule associated protein 1 light chain 3 beta, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B |
Gene ID (Entrez) | 81631 |
Formulation | PBS with 0.02% Sodium Azide |
Immunogen | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Human, rat, mouse, zebrafish, bacteria, hamster, and porcine. Bovine reactivity reported in scientific literature (PMID: 24895572) Primate reactivity reported in scientific literature (PMID: 25142602) The mouse detection has been reported to be weaker than the human. Immunogen sequence has 84% homology to Xenopus. |
Target Species | C. elegans,Plant |
---|
Highly purified. Generating reliable and reproducible results.
Regulatory Status | RUO |
---|---|
Purification Method | SDS-PAGE |
Purity or Quality Grade | >95% |
Conjugate | Unconjugated |
Common Name | beta 2-Microglobulin |
Molecular Weight (g/mol) | 14.0kDa |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
Concentration | 0.5mg/mL |
For Use With (Application) | SDS-PAGE |
Highly purified and high bioactivity. Generating reliable and reproducible results.
Conjugate | Unconjugated |
---|---|
Gene Symbol | SNCA |
For Use With (Application) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Source | E.Coli |
Name | Human alpha-Synuclein Aggregate Protein |
Regulatory Status | RUO |
Purification Method | >95% pure by SDS-PAGE |
Gene Alias | alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) |
Product Type | Recombinant Protein |
Gene ID (Entrez) | 6622 |
Formulation | PBS |
Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Cross Reactivity | Human |
Recombinant | Recombinant |
Antigen | Ferroportin/SLC40A1 |
---|---|
Target Species | Human,Mouse,Pig,Bovine |
Host Species | Rabbit |
Applications | Western Blot,Immunohistochemistry (Paraffin) |
Mouse Monoclonal Antibody
Mouse Monoclonal Antibody has been used in 7 publications
Purity or Quality Grade | >98% pure by SDS-PAGE and HPLC |
---|---|
Molecular Weight (g/mol) | 16.9 kDa |
Gene Symbol | IFNG |
Endotoxin Concentration | Less than 1 EU/ug of IFN-gamma as determined by LAL method. |
Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
Concentration | LYOPH |
For Use With (Application) | PAGE,Bioactivity |
Protein | IFN-gamma |
Accession Number | P01579 |
Gene Alias | IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma |
Gene ID (Entrez) | 3458 |
Formulation | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
Research Category | Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers |
Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
Rabbit Polyclonal Antibody has been used in 6 publications
Hasta el 16 de diciembre, ahorre hasta un 35 % en los esenciales de R&D Systems que impulsan la precisión y el rendimiento en su investigación.