Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
946,867
results
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG2a |
| Gene Accession No. | P21796 |
| Research Discipline | Cellular Markers, Mitochondrial Markers |
| Concentration | 1 mg/mL |
| Antigen | VDAC1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence |
| Gene Alias | hVDAC1, MGC111064, Outer mitochondrial membrane protein porin 1, Plasmalemmal porin, PORIN, Porin 31HL, Porin 31HM, PORIN-31-HL, VDAC, VDAC-1, voltage-dependent anion channel 1, voltage-dependent anion-selective channel protein 1 |
| Gene ID (Entrez) | 7416 |
| Formulation | PBS (pH 7.4), 50% Glycerol |
| Immunogen | Fusion protein amino acids 1-283 (full-length) of human VDAC1. Mouse: 98% identity (279/283 amino acids identical). Rat: 98% identity (279/283 amino acids identical) >60% identity with VDAC2 and VDAC3. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S152B-23 |
Goat anti-Mouse IgG (H+L) Secondary Antibody, HRP, Novus Biologicals™
Goat Polyclonal Antibody has been used in 18 publications
Goat anti-Mouse IgG (H+L) Secondary Antibody, HRP (Pre-adsorbed), Novus Biologicals™
Goat Polyclonal Antibody has been used in 2 publications
Integrin alpha 6/CD49f Antibody (GoH3), Alexa Fluor™ 532, Novus Biologicals™
Rat Monoclonal Antibody
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown |
| Isotype | IgG |
| Research Discipline | Breast Cancer, DNA Repair, Homologous Recombination |
| Antigen | RAD52 |
| Gene Symbols | RAD52 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated |
| Gene Alias | DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23 |
| Gene ID (Entrez) | 5893 |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Regulatory Status | RUO |
|---|---|
| Host Species | Rabbit |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunofluorescence |
| Isotype | IgG |
| Antigen | DNA2 |
| Gene Symbols | DNA2 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Gene ID (Entrez) | 1763 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Gene Symbols | MAP1LC3B |
|---|---|
| Content And Storage | Store at -20°C. |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
| Target Species | Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Host Species | Rabbit |
| Immunogen | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Isotype | IgG |