Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
951,841
results
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q14674 |
| Research Discipline | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Concentration | 0.9 mg/mL |
| Antigen | Separase |
| Gene Symbols | ESPL1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:500 |
| Gene Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gene ID (Entrez) | 9700 |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | XJ11-1B12 |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | Q5VX71 |
| Antigen | SUSD4 |
| Gene Symbols | SUSD4 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Gene Alias | FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196 |
| Gene ID (Entrez) | 55061 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVN |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Antigen | COX4-I1 |
| Regulatory Status | RUO |
| Purification Method | Antigen and protein A Affinity-purified |
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:300-1:10000, Immunohistochemistry-Paraffin 1:1000-1:5000 |
| Formulation | 0.2 um filtered solution in PBS |
| Immunogen | Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of the Human COX4-I1. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
CD31/PECAM-1 Antibody (MEC13.3) - BSA Free, Novus Biologicals™
Rat Monoclonal Antibody has been used in 17 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Frozen),In vitro Assay,CyTOF |
| Form | Purified |
| Isotype | IgG2a κ |
| Research Discipline | Angiogenesis, Cancer, Cellular Markers, Embryonic Stem Cell Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers |
| Concentration | 1.0 mg/mL |
| Antigen | CD31/PECAM-1 |
| Gene Symbols | PECAM1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Flow Cytometry 2.5 ug/ml, Immunohistochemistry 1:100-1:500, Immunocytochemistry/Immunofluorescence 1:500 - 1:1000, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Frozen 1:100, In vitro assay reported in scientific literature (PMID 24647208), In vivo assay reported in scientific literature, Flow (Cell Surface) 2.5 ug/ml, CyTOF-ready |
| Molecular Weight of Antigen | 82.5 kDa |
| Gene Alias | adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA′, MEC 13.3 CD31, MEC 13.3 Clone, PECA1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule |
| Gene ID (Entrez) | 5175 |
| Immunogen | This CD31/PECAM-1 Antibody (MEC13.3) was developed against mouse endothelial cell line T-end. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MEC13.3 |
Histone H3, Trimethyl Lys9 Antibody (6F12-H4), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 19 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Pig,C. elegans,Drosophila,Invertebrate,Mammalia,Yeast |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | P84243, P84244 |
| Research Discipline | Chromatin Modifiers, Chromatin Research, Epigenetics, Histones and Modified Histones, Loading Controls |
| Concentration | 1 mg/mL |
| Antigen | Histone H3 (Trimethyl Lys9) |
| Gene Symbols | H3C14 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:2000, ELISA 1:100-1:2000, Immunohistochemistry 1:1000. Use reported in scientific literature (PMID 23872316), Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 1:10-1:500. Use reported in scientific literature (PMID 28270554), Immunohistochemistry-Paraffin 1:1000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 |
| Molecular Weight of Antigen | 15 kDa |
| Gene Alias | H3, H3 histone, family 3A, H3.3A, H3.3B, H3F2, H3F3, H3F3B, H3FM, H3K9Me3, HIST2H3C, histone H3.3, MGC87782, MGC87783 |
| Gene ID (Entrez) | 126961 |
| Immunogen | This Histone H3 [Trimethyl Lys9] antibody (6F12-H4) was raised against a synthetic peptide made to an N-terminal region of Histone H3 (between amino acids 1-50). [UniProt# P84243] |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | All mammals including human, mouse and rat, Drosophila, C. elegans, yeast. Invertebrate/Blattella germanica (German cockroach) reactivity reported in scientific literature (PMID: 23872316). |
| Clone | 6F12-H4 |
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |