missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 18242584

Novus Biologicals™ Recombinant Human AlphaB Crystallin/CRYAB Protein

Código de producto. 18242584 Tienda Bio Techne Productos
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto.
18242584 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18242584 Proveedor Novus Biologicals™ N.º de proveedor NBC118352

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-175 of Human AlphaB Crystallin/CRYAB The Recombinant Human AlphaB Crystallin/CRYAB Protein is derived from E. coli. The Recombinant Human AlphaB Crystallin/CRYAB Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso NP_001876.1
Para utilizar con (aplicación) ELISA, SDS-PAGE
Formulación 20mM Tris-HCl buffer (pH 7.5), 50mM NaCl, 1mM EDTA
ID de gen (Entrez) 1410
Peso molecular 20.1kDa
Nombre AlphaB Crystallin/CRYAB protein
Método de purificación Protein
Inmunógeno MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Requisitos de almacenamiento −80°C. Avoid freeze-thaw cycles.
Reactividad cruzada Human
Grado de pureza o calidad >95%, by SDS-PAGE
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.