Gefilterte Suchergebnisse
Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte
deaktivieren Sie alle Filter,
um diese Produkte zu sehen.
1
–
15
von
951,841
Ergebnisse
| Gensymbol | SNCA |
|---|---|
| Zusammensetzung | PBS pH 7.4 |
| Lagerungsbedingungen | Store at -80C. Avoid freeze-thaw cycles. |
| Forschungskategorie | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Zur Verwendung mit (Anwendung) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Gen-Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Protein | alpha-Synuclein |
| Reinheits- oder Qualitätsgrad | >95%, by SDS-PAGE |
| Gen-ID (Entrez) | 6622 |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Gensymbole | TP53BP1 |
|---|---|
| Gen-Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Inhalt und Lagerung | Store at -20°C. |
|---|---|
| Immunogen | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Zielspezies | Porcine,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Isotype | IgG |
| Gensymbole | MAP1LC3B |
| Reinigungsverfahren | Affinity Purified |
| Verdünnung | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
| Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | PANX1 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | Pannexin-1 |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Zielspezies | Human |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated |
| Gen-Alias | MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 |
| Gen-ID (Entrez) | 24145 |
Sirtuin 1/SIRT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
| Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | SIRT1 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | Sirtuin 1/SIRT1 |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD |
| Zielspezies | Human |
| Forschungsgebiet | Apoptosis, Chromatin Research, DNA Repair, Epigenetics, Histone Deacetylases |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Gen-Alias | EC 3.5.1, S. cerevisiae, homolog) 1, sirtuin 1 |
| Gen-ID (Entrez) | 23411 |
| Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | TMC5 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | TMC5 |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR |
| Zielspezies | Human |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Gen-Alias | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Gen-ID (Entrez) | 79838 |
Carbonic Anhydrase IX/CA9 Antibody (2D3) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
| Klon | 2D3 |
|---|---|
| Form | Purified |
| Gen-Zugriffsnummer | Q16790 |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Gensymbole | CA9 |
| Konzentration | 1.0 mg/mL |
| Primär oder sekundär | Primary |
| Molekulargewicht des Antigens | 50 kDa |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Carbonic Anhydrase IX/CA9 |
| Regulatorischer Status | RUO |
| Immunogen | Purified recombinant fragment of human Carbonic Anhydrase IX expressed in E. coli. [UniProt# Q16790] |
| Zielspezies | Human,Mouse |
| Forschungsgebiet | Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein A or G purified |
| Anwendungen | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 1:2000, Flow Cytometry 1:200-1:400, ELISA 1:10000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:1000, Flow (Intracellular) 1 ug/mL, CyTOF-ready |
| Gen-Alias | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
| Gen-ID (Entrez) | 768 |
| Form | Purified |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.3), 50% glycerol |
| Klassifikation | Polyclonal |
| Antigen | TMC5 |
| Regulatorischer Status | RUO |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA |
| Zielspezies | Human |
| Forschungsgebiet | Cell Biology |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1:500-1:2000 |
| Gen-Alias | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Gen-ID (Entrez) | 79838 |
| Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | TMC5 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | TMC5 |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGSLWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVH |
| Zielspezies | Human |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gen-Alias | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Gen-ID (Entrez) | 79838 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Testspezifität | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
|---|---|
| Klon | p6007 |
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | 0.2um-filtered solution in PBS, pH 7.4. |
| Klassifikation | Monoclonal |
| Antigen | Listeria monocytogenes p60 |
| Regulatorischer Status | RUO |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Zielspezies | Bacteria |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot,ELISA |
| Verdünnung | Western Blot, ELISA |
| Gen-Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |