missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ URI Recombinant Protein Antigen

Código de producto. 18294492 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μl
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18294492 100 μl 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18294492 Proveedor Novus Biologicals™ N.º de proveedor NBP257701PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human URI. Source: E.coli Amino Acid Sequence: ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK The URI Recombinant Protein Antigen is derived from E. coli. The URI Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 8725
Método de purificación >80% by SDS-PAGE and Coomassie blue staining
Nombre común URI Recombinant Protein Antigen
Contenido y almacenamiento Store at −20°C. Avoid freeze-thaw cycles
Formulación PBS and 1M Urea, pH 7.4
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Alias de gen chromosome 19 open reading frame 2, FLJ10575, NNX3RPB5-mediating protein, Protein NNX3, RMPunconventional prefoldin RPB5 interactor, RNA polymerase II subunit 5-mediating protein, URIRNA polymerase II, subunit 5-mediating protein
Símbolo de gen URI1
Tipo de etiqueta Unlabeled
Tipo de producto Recombinant Protein Antigen
Cantidad 100 μl
Estado normativo RUO
Fuente E.coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53306. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mostrar más Mostrar menos

Para uso exclusivo en investigación.

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.