missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. UCH-L1/PGP9.5 Antibody, Novus Biologicals™

UCH-L1/PGP9.5 Antibody, Novus Biologicals™

Código de producto. 18491051 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18491051 25 μL 25 microlitros
18473351 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18491051 Proveedor Novus Biologicals N.º de proveedor NBP18733425ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

UCH-L1/PGP9.5 Polyclonal antibody specifically detects UCH-L1/PGP9.5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno UCH-L1/PGP9.5
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen EC 3.4.19.12, EC 6.-, Neuron cytoplasmic protein 9.5, PARK5, PGP 9.5, PGP9.5, PGP9.5Uch-L1, PGP95, ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase), ubiquitin carboxyl-terminal hydrolase isozyme L1, ubiquitin C-terminal hydrolase, Ubiquitin thioesterase L1, UCHL1, UCH-L1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Alzheimers Research, Cellular Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission
Primario o secundario Primary
ID de gen (Entrez) 7345
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.