missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. TRAF7 Antibody, Novus Biologicals™

TRAF7 Antibody, Novus Biologicals™

Código de producto. 18254411 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18254411 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18254411 Proveedor Novus Biologicals N.º de proveedor NBP158999

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

TRAF7 Polyclonal specifically detects TRAF7 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno TRAF7
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen Q6Q0C0
Alias de gen DKFZp586I021, E3 ubiquitin-protein ligase TRAF7, EC 6.3.2.-, MGC7807, RFWD1RING finger protein 119, RNF119RING finger and WD repeat-containing protein 1, TNF receptor-associated factor 7ring finger and WD repeat domain 1
Símbolos de los genes TRAF7
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to TRAF7(TNF receptor-associated factor 7) The peptide sequence was selected from the N terminal of TRAF7. Peptide sequence GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR.
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Lipid and Metabolism, Zinc Finger
Primario o secundario Primary
ID de gen (Entrez) 84231
Especificidad de la prueba Expected identity based on immunogen sequence: Chicken: 85%.
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.