missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 30498206

TIA1 Antibody [DyLight 680], Novus Biologicals Biologicals™

Código de producto. 30498206 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
Tamaño de la unidad:
0.10 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30498206 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30498206 Proveedor Novus Biologicals N.º de proveedor NBP335245FR

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

TIA1 Polyclonal antibody specifically detects TIA1 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno TIA1
Aplicaciones ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Clasificación Polyclonal
Conjugado DyLight 680
Formulación 50mM Sodium Borate
Alias de gen cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protein, TIA1 cytotoxic granule-associated RNA-binding protein
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1 (NP_071505.2).,, Sequence:, IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Método de purificación Affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Adaptive Immunity, Apoptosis, Immunology
Primario o secundario Primary
ID de gen (Entrez) 7072
Especies diana Human, Mouse
Contenido y almacenamiento Store at 4°C in the dark.
Tipo de producto Antibody
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.