missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 30503782

TCIRG1 Antibody [DyLight 755], Novus Biologicals Biologicals™

Código de producto. 30503782 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad
30503782 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30503782 Proveedor Novus Biologicals N.º de proveedor NBP335541IR

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

TCIRG1 Polyclonal antibody specifically detects TCIRG1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno TCIRG1
Aplicaciones ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Clasificación Polyclonal
Conjugado DyLight 755
Formulación 50mM Sodium Borate
Alias de gen a3, Atp6i, ATP6N1Cspecific 116-kDa vacuolar proton pump subunit, ATP6V0A3T-cell immune response cDNA 7, OC-116, OC-116 kDa, OC-116kDa, OC116Vph1, OPTB1, Osteoclastic proton pump 116 kDa subunit, Stv1, T-cell immune regulator 1, T-cell immune response cDNA7 protein, T-cell, immune regulator 1, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, TIRC7ATPase, H+ transporting, 116kD, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3, V-ATPase 116 kDa isoform a3, V-ATPase 116-kDa, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 3
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TCIRG1 (NP_006010.2).,, Sequence:, MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAA
Método de purificación Affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Immunology
Primario o secundario Primary
ID de gen (Entrez) 10312
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at 4°C in the dark.
Tipo de producto Antibody
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.