missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SYS1 Polyclonal specifically detects SYS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antígeno | SYS1 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | C20orf169, chromosome 20 open reading frame 169, dJ453C12.4, dJ453C12.4.1, protein SYS1 homolog, SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) |
| Símbolos de los genes | SYS1 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?