missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
SUB1 Polyclonal antibody specifically detects SUB1 in Human,Mouse samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antígeno | SUB1 |
| Aplicaciones | ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | DyLight 550 |
| Formulación | 50mM Sodium Borate |
| Alias de gen | activated RNA polymerase II transcription cofactor 4, activated RNA polymerase II transcriptional coactivator p15, MGC102747, p15, PC4p14P15, Positive cofactor 4, RPO2TC1, SUB1 homolog, SUB1 homolog (S. cerevisiae) |
| Especie del huésped | Rabbit |
| Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human SUB1 (NP_006704.3).,, Sequence:, MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL |
| Método de purificación | Affinity purified |
| Cantidad | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?