missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. SNX33 Antibody, R&D Systems™

SNX33 Antibody, R&D Systems™

Código de producto. 18499030 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
0.1 mL
25ul
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18499030 25ul 25 microlitros
18254377 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18499030 Proveedor Novus Biologicals N.º de proveedor NBP18112525ul
  • ONLINE EXCLUSIVE PRICE
    433.00€
    409.50€ / 25 microlitros
    Ahorro 23.50€
    5% Descuento
 Artículo restringido
Fecha estimada de envoi: 09-10-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SNX33 Polyclonal specifically detects SNX33 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno SNX33
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q8WV41
Alias de gen MGC32065, SH3 and PX domain containing 3, SH3PXD3CSH3PX3, SNX30SH3 and PX domain-containing protein 3, sorting nexin 33, sorting nexin-33
Símbolos de los genes SNX33
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
Método de purificación Affinity Purified
Cantidad 25ul
Estado normativo RUO
Disciplina de investigación Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 257364
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.