missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. SLC22A7 Antibody, Novus Biologicals™

SLC22A7 Antibody, Novus Biologicals™

Código de producto. p-7108562 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18025375 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18025375 Proveedor Novus Biologicals N.º de proveedor NBP162660

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

SLC22A7 Polyclonal specifically detects SLC22A7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno SLC22A7
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Concentración 1 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen Q5T048
Alias de gen hOAT2, liver-specific transporter, NLTMGC45202, Novel liver transporter, OAT2MGC24091, Organic anion transporter 2, solute carrier family 22 (organic anion transporter), member 7, solute carrier family 22 member 7
Símbolos de los genes SLC22A7
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS The peptide sequence for this immunogen was taken from within the described region.
Peso molecular del antígeno 60 kDa
Método de purificación Protein A purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 10864
Especificidad de la prueba Rat: 86%.
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Rat, Bovine, Equine, Guinea Pig, Rabbit
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.