missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC1A5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-59732
This item is not returnable.
View return policy
Description
SLC1A5 Polyclonal antibody specifically detects SLC1A5 in Human, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications
| SLC1A5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5 | |
| Rabbit | |
| 60 kDa | |
| 100 μL | |
| Primary | |
| Zebrafish 86%. | |
| Human, Bovine, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml | |
| Q71UA6 | |
| SLC1A5 | |
| Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5 (NP_005619). Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV The peptide sequence for this immunogen was taken from within the described region. | |
| Protein A purified | |
| RUO | |
| 6510 | |
| Reconstitute in 100μL distilled water to a final antibody concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction