missing translation for 'onlineSavingsMsg'
Learn More

SLC1A5 Antibody, Novus Biologicals™

Código de producto. 18740264 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18740264 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18740264 Proveedor Novus Biologicals N.º de proveedor NBP159732

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

SLC1A5 Polyclonal antibody specifically detects SLC1A5 in Human, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno SLC1A5
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Concentración 1 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen Q71UA6
Alias de gen AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5
Símbolos de los genes SLC1A5
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5 (NP_005619). Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV The peptide sequence for this immunogen was taken from within the described region.
Peso molecular del antígeno 60 kDa
Método de purificación Protein A purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 6510
Especificidad de la prueba Zebrafish 86%.
Reconstitución Reconstitute in 100μL distilled water to a final antibody concentration of 1mg/mL.
Especies diana Human, Bovine, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.