SLC1A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca: Novus Biologicals NBP1-59732

Product Code. 18740264

508.00€ / 100 microlitros

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

SLC1A5 Polyclonal antibody specifically detects SLC1A5 in Human, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antígeno	SLC1A5
Clasificación	Polyclonal
Conjugado	Unconjugated
Formulación	PBS, 2% Sucrose with 0.09% Sodium Azide
Alias de gen	AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5
Especie del huésped	Rabbit
Peso molecular del antígeno	60 kDa
Cantidad	100 μL
Primario o secundario	Primary
Especificidad de la prueba	Zebrafish 86%.
Especies diana	Human, Bovine, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Formulario	Purified

Aplicaciones	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentración	1 mg/ml
Dilución	Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
N.º de referencia del gen	Q71UA6
Símbolos de los genes	SLC1A5
Inmunógeno	Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5 (NP_005619). Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV The peptide sequence for this immunogen was taken from within the described region.
Método de purificación	Protein A purified
Estado normativo	RUO
ID de gen (Entrez)	6510
Reconstitución	Reconstitute in 100μL distilled water to a final antibody concentration of 1mg/mL.
Contenido y almacenamiento	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

SLC1A5 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions