missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
RRAGA Polyclonal antibody specifically detects RRAGA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | RRAGA |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulación | PBS (pH 7.3), 50% glycerol |
| Alias de gen | Adenovirus E3 14.7 kDa-interacting protein 1, FIP1, FIP-1adenovirus E3-14.7K interacting protein 1, Rag A, RagA, RAGAras-related GTP-binding protein A, Ras-related GTP binding A |
| Especie del huésped | Rabbit |
| Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 213-313 of human RRAGA (NP_006561.1). VISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR |
| Método de purificación | Affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?