missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. RhoB Antibody - Azide and BSA Free, R&D Systems™

RhoB Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18621222 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Unit Size:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad Unit Size
18621222 0.02 mL 0.02 ml
18649551 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18621222 Supplier Novus Biologicals Supplier No. NBP2941040.02ml
 Artículo restringido
Fecha estimada de envoi: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

RhoB Polyclonal specifically detects RhoB in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno RhoB
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, RHOH6RhoB, rho-related GTP-binding protein RhoB
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1). VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Angiogenesis
Primario o secundario Primary
ID de gen (Entrez) 388
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.