missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. enQuireBio™ Recombinant HPV HPV 18 Protein

enQuireBio™ Recombinant HPV HPV 18 Protein

Código de producto. 15920009
Change view
Click to view available options
Cantidad:
100 μg
1 mg
500 μg
Tamaño de la unidad:
1 miligramo
100 microgramos
500 microgramos
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
15920009 100 μg 100 microgramos
15940009 500 μg 500 microgramos
15930009 1 mg 1 miligramo
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 15920009 Proveedor enQuireBio™ N.º de proveedor QP12308100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.

Especificaciones

Nombre HPV HPV 18 Protein
Cantidad 100 μg
Estado normativo Research Use Only
Concentración de endotoxinas Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Tipo de producto Recombinant Protein
Reactividad cruzada HPV
Especie E. coli
Etiqueta de proteína GST
Secuencia VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Tampón Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Grado de pureza o calidad Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.