missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. RCAN2 Antibody, Novus Biologicals™

RCAN2 Antibody, Novus Biologicals™

Código de producto. 18277415 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18277415 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18277415 Proveedor Novus Biologicals N.º de proveedor NBP179477

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

RCAN2 Polyclonal specifically detects RCAN2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno RCAN2
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen NP_005813
Alias de gen Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2), calcipressin-2, Down syndrome candidate region 1-like 1, Down syndrome critical region gene 1-like 1, DSCR1L1MCIP2ZAKI4RCN2, hRCN2, Myocyte-enriched calcineurin-interacting protein 2, regulator of calcineurin 2CSP2, thyroid hormone-responsive (skin fibroblasts), Thyroid hormone-responsive protein ZAKI-4, ZAKI-4
Símbolos de los genes RCAN2
Especie del huésped Rabbit
Inmunógeno Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG.
Peso molecular del antígeno 22 kDa
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 10231
Especificidad de la prueba Expected identity based on immunogen sequence: Chicken: 85%.
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.