missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
PSMD6 Polyclonal specifically detects PSMD6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
Especificaciones
| Antígeno | PSMD6 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | 26S proteasome non-ATPase regulatory subunit 6, Breast cancer-associated protein SGA-113M, KIAA010726S proteasome regulatory subunit S10, p42A, p44S10, PFAAP4, Phosphonoformate immuno-associated protein 4, proteasome (prosome, macropain) 26S subunit, non-ATPase, 6,26S proteasome regulatory subunit RPN7, Proteasome regulatory particle subunit p44S10, Rpn7, S10, SGA-113M |
| Símbolos de los genes | PSMD6 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:NMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALG |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?