missing translation for 'onlineSavingsMsg'
Learn More

PPAP2B Antibody, Novus Biologicals™

Código de producto. 18498920 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18498920 25 μL 25 microlitros
18766983 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18498920 Proveedor Novus Biologicals N.º de proveedor NBP18282525ul
  • ONLINE EXCLUSIVE PRICE
    433.00€
    409.50€ / 25 microlitros
    Ahorro 23.50€
    5% Descuento
 Artículo restringido
Fecha estimada de envoi: 24-09-2026
Añadir a la cesta
Añadir a la cesta
Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

PPAP2B Polyclonal specifically detects PPAP2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno PPAP2B
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP2b, PAP-2b, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP
Símbolos de los genes PLPP3
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Protein Phosphatase
Primario o secundario Primary
ID de gen (Entrez) 8613
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.