missing translation for 'onlineSavingsMsg'
Learn More

Pit1 Antibody, Novus Biologicals™

Código de producto. 18404291 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
Tamaño de la unidad:
25 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18404291 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18404291 Proveedor Novus Biologicals N.º de proveedor NBP19227325ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 13 publications

Pit1 Polyclonal specifically detects Pit1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Pit1
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a
Símbolos de los genes POU1F1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Breast Cancer, Cell Cycle and Replication
Primario o secundario Primary
ID de gen (Entrez) 5449
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Mouse
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.