missing translation for 'onlineSavingsMsg'
Learn More

PHACS Antibody, Novus Biologicals™

Código de producto. 18498679 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
0.05 mg
Tamaño de la unidad:
50 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
18498679 0.05 mg 50 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18498679 Proveedor Novus Biologicals N.º de proveedor H00084680B01P
 Artículo restringido
Fecha estimada de envoi: 01-10-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Mouse Polyclonal Antibody

PHACS Polyclonal antibody specifically detects PHACS in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antígeno PHACS
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500
Formulación PBS (pH 7.4)
N.º de referencia del gen AAH20197.1
Alias de gen 1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional), 1-aminocyclopropane-1-carboxylate synthase-like protein 1, PHACSACSACC synthase-like protein 1
Especie del huésped Mouse
Inmunógeno PHACS (AAH20197.1, 1 a.a. - 501 a.a.) full-length human protein. MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLLKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRPSQSQEPSDQRR
Método de purificación Protein A purified
Cantidad 0.05 mg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 84680
Especies diana Human
Contenido y almacenamiento Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.